Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00051388-B03P |
Product name: | NIP7 purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NIP7 protein. |
Gene id: | 51388 |
Gene name: | NIP7 |
Gene alias: | CGI-37|FLJ10296|HSPC031|KD93 |
Gene description: | nuclear import 7 homolog (S. cerevisiae) |
Genbank accession: | NM_016101.3 |
Immunogen: | NIP7 (NP_057185.1, 1 a.a. ~ 180 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT |
Protein accession: | NP_057185.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NIP7 expression in transfected 293T cell line (H00051388-T01) by NIP7 MaxPab polyclonal antibody. Lane 1: NIP7 transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |