No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051382-M01 |
Product name: | ATP6V1D monoclonal antibody (M01), clone 3G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V1D. |
Clone: | 3G4 |
Isotype: | IgG2a Kappa |
Gene id: | 51382 |
Gene name: | ATP6V1D |
Gene alias: | ATP6M|VATD|VMA8 |
Gene description: | ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D |
Genbank accession: | NM_015994 |
Immunogen: | ATP6V1D (NP_057078, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRR |
Protein accession: | NP_057078 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to ATP6V1D on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |