| Brand: | Abnova |
| Reference: | H00051382-M01 |
| Product name: | ATP6V1D monoclonal antibody (M01), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V1D. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51382 |
| Gene name: | ATP6V1D |
| Gene alias: | ATP6M|VATD|VMA8 |
| Gene description: | ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D |
| Genbank accession: | NM_015994 |
| Immunogen: | ATP6V1D (NP_057078, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRR |
| Protein accession: | NP_057078 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ATP6V1D on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml] |
| Applications: | IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |