| Brand: | Abnova |
| Reference: | H00051377-P01 |
| Product name: | UCHL5 (Human) Recombinant Protein (P01) |
| Product description: | Human UCHL5 full-length ORF ( AAH15521, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 51377 |
| Gene name: | UCHL5 |
| Gene alias: | CGI-70|INO80R|UCH37 |
| Gene description: | ubiquitin carboxyl-terminal hydrolase L5 |
| Genbank accession: | BC015521.1 |
| Immunogen sequence/protein sequence: | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK |
| Protein accession: | AAH15521 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Systematic characterization of deubiquitylating enzymes for roles in maintaining genome integrity.Nishi R, Wijnhoven P, le Sage C, Tjeertes J, Galanty Y, Forment JV, Clague MJ, Urbe S, Jackson SP Nat Cell Biol. 2014 Oct;16(10):1016-26. doi: 10.1038/ncb3028. Epub 2014 Sep 7. |