Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00051374-B01P |
Product name: | C2orf28 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human C2orf28 protein. |
Gene id: | 51374 |
Gene name: | C2orf28 |
Gene alias: | APR--3|APR-3|APR3|HSPC013|PRO240|p18 |
Gene description: | chromosome 2 open reading frame 28 |
Genbank accession: | NM_016085 |
Immunogen: | C2orf28 (NP_057169.2, 1 a.a. ~ 171 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
Protein accession: | NP_057169.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of C2orf28 expression in transfected 293T cell line (H00051374-T02) by C2orf28 MaxPab polyclonal antibody. Lane 1: C2orf28 transfected lysate(18.81 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |