Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C2orf28 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about C2orf28 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00051374-B01 |
| Product name: | C2orf28 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C2orf28 protein. |
| Gene id: | 51374 |
| Gene name: | C2orf28 |
| Gene alias: | APR--3|APR-3|APR3|HSPC013|PRO240|p18 |
| Gene description: | chromosome 2 open reading frame 28 |
| Genbank accession: | NM_016085 |
| Immunogen: | C2orf28 (NP_057169, 1 a.a. ~ 171 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
| Protein accession: | NP_057169 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C2orf28 expression in transfected 293T cell line (H00051374-T01) by C2orf28 MaxPab polyclonal antibody. Lane 1: C2orf28 transfected lysate(18.81 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |