Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051371-B02P |
Product name: | POMP purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human POMP protein. |
Gene id: | 51371 |
Gene name: | POMP |
Gene alias: | C13orf12|HSPC014|PNAS-110|UMP1 |
Gene description: | proteasome maturation protein |
Genbank accession: | NM_015932.2 |
Immunogen: | POMP (NP_057016.1, 1 a.a. ~ 141 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL |
Protein accession: | NP_057016.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POMP expression in transfected 293T cell line (H00051371-T03) by POMP MaxPab polyclonal antibody. Lane 1: POMP transfected lysate(15.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |