No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00051364-M05 |
Product name: | ZMYND10 monoclonal antibody (M05), clone 3A6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZMYND10. |
Clone: | 3A6 |
Isotype: | IgG2b Kappa |
Gene id: | 51364 |
Gene name: | ZMYND10 |
Gene alias: | BLU|FLU |
Gene description: | zinc finger, MYND-type containing 10 |
Genbank accession: | BC033732 |
Immunogen: | ZMYND10 (AAH33732, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK |
Protein accession: | AAH33732 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZMYND10 expression in transfected 293T cell line by ZMYND10 monoclonal antibody (M05), clone 3A6. Lane 1: ZMYND10 transfected lysate (Predicted MW: 50.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr |
Shipping condition: | Dry Ice |