Cart 53 Product Products 16 059,07 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x KEPI...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-Lc...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
16 059,07 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 53 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 059,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 059,07 €
Data sheet of ZMYND10 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ZMYND10 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00051364-B01P |
| Product name: | ZMYND10 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZMYND10 protein. |
| Gene id: | 51364 |
| Gene name: | ZMYND10 |
| Gene alias: | BLU|FLU |
| Gene description: | zinc finger, MYND-type containing 10 |
| Genbank accession: | NM_015896.2 |
| Immunogen: | ZMYND10 (NP_056980.2, 1 a.a. ~ 440 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK |
| Protein accession: | NP_056980.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZMYND10 expression in transfected 293T cell line (H00051364-T01) by ZMYND10 MaxPab polyclonal antibody. Lane 1: ZMYND10 transfected lysate(48.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |