HOOK1 polyclonal antibody (A01) View larger

HOOK1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOOK1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HOOK1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051361-A01
Product name: HOOK1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HOOK1.
Gene id: 51361
Gene name: HOOK1
Gene alias: HK1|MGC10642
Gene description: hook homolog 1 (Drosophila)
Genbank accession: NM_015888
Immunogen: HOOK1 (NP_056972, 632 a.a. ~ 728 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTPARSFLAQQRHITNTRRNLSVKVPATTSD
Protein accession: NP_056972
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051361-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051361-A01-1-34-1.jpg
Application image note: HOOK1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of HOOK1 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOOK1 polyclonal antibody (A01) now

Add to cart