| Brand: | Abnova |
| Reference: | H00051348-A01 |
| Product name: | KLRF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KLRF1. |
| Gene id: | 51348 |
| Gene name: | KLRF1 |
| Gene alias: | CLEC5C|MGC119907|MGC119908|MGC119909 |
| Gene description: | killer cell lectin-like receptor subfamily F, member 1 |
| Genbank accession: | NM_016523 |
| Immunogen: | KLRF1 (NP_057607, 69 a.a. ~ 166 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLR |
| Protein accession: | NP_057607 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | KLRF1 polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of KLRF1 expression in NIH/3T3. (Isoform : 9.028 kDa) |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |