Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051330-B01P |
Product name: | TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TNFRSF12A protein. |
Gene id: | 51330 |
Gene name: | TNFRSF12A |
Gene alias: | CD266|FN14|TWEAKR |
Gene description: | tumor necrosis factor receptor superfamily, member 12A |
Genbank accession: | DQ896216.2 |
Immunogen: | TNFRSF12A (ABM87215.1, 1 a.a. ~ 129 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Protein accession: | ABM87215.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFRSF12A expression in transfected 293T cell line (H00051330-T01) by TNFRSF12A MaxPab polyclonal antibody. Lane 1: TNFRSF12A transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |