No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051329-M09 |
Product name: | ARL6IP4 monoclonal antibody (M09), clone 5E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARL6IP4. |
Clone: | 5E5 |
Isotype: | IgG2a Kappa |
Gene id: | 51329 |
Gene name: | ARL6IP4 |
Gene alias: | MGC814|SR-25|SRp25 |
Gene description: | ADP-ribosylation-like factor 6 interacting protein 4 |
Genbank accession: | NM_018694 |
Immunogen: | ARL6IP4 (NP_061164, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP |
Protein accession: | NP_061164 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to ARL6IP4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | SRrp37, a novel splicing regulator located in the nuclear speckles and nucleoli, interacts with SC35 and modulates alternative pre-mRNA splicing in vivo.Ouyang P. J Cell Biochem. 2009 Sep 1;108(1):304-14. |