Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARL6IP4 monoclonal antibody (M09), clone 5E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about ARL6IP4 monoclonal antibody (M09), clone 5E5
| Brand: | Abnova |
| Reference: | H00051329-M09 |
| Product name: | ARL6IP4 monoclonal antibody (M09), clone 5E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARL6IP4. |
| Clone: | 5E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51329 |
| Gene name: | ARL6IP4 |
| Gene alias: | MGC814|SR-25|SRp25 |
| Gene description: | ADP-ribosylation-like factor 6 interacting protein 4 |
| Genbank accession: | NM_018694 |
| Immunogen: | ARL6IP4 (NP_061164, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP |
| Protein accession: | NP_061164 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ARL6IP4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SRrp37, a novel splicing regulator located in the nuclear speckles and nucleoli, interacts with SC35 and modulates alternative pre-mRNA splicing in vivo.Ouyang P. J Cell Biochem. 2009 Sep 1;108(1):304-14. |