No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051327-M17 |
Product name: | ERAF monoclonal antibody (M17), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ERAF. |
Clone: | 3C9 |
Isotype: | IgG1 Kappa |
Gene id: | 51327 |
Gene name: | ERAF |
Gene alias: | AHSP|EDRF |
Gene description: | erythroid associated factor |
Genbank accession: | NM_016633 |
Immunogen: | ERAF (NP_057717, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS |
Protein accession: | NP_057717 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ERAF is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Transgenic human alpha-hemoglobin stabilizing protein could partially relieve betaIVS-2-654-thalassemia syndrome in model mice.Wang B, Fang Y, Guo X, Ren Z, Zhang J. Hum Gene Ther. 2010 Feb;21(2):149-56. |