Cart 13 Product Products 4 666,62 € (empty)
No products
To be determined Shipping
4 666,62 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 13 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 666,62 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 666,62 €
Data sheet of ERAF polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about ERAF polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051327-A01 |
| Product name: | ERAF polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ERAF. |
| Gene id: | 51327 |
| Gene name: | ERAF |
| Gene alias: | AHSP|EDRF |
| Gene description: | erythroid associated factor |
| Genbank accession: | NM_016633 |
| Immunogen: | ERAF (NP_057717, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS |
| Protein accession: | NP_057717 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ERAF expression in transfected 293T cell line by ERAF polyclonal antibody (A01). Lane1:ERAF transfected lysate(11.84 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |