SPG21 polyclonal antibody (A01) View larger

SPG21 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPG21 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SPG21 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051324-A01
Product name: SPG21 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SPG21.
Gene id: 51324
Gene name: SPG21
Gene alias: ACP33|BM-019|GL010|MASPARDIN|MAST
Gene description: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Genbank accession: NM_016630
Immunogen: SPG21 (NP_057714, 211 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Protein accession: NP_057714
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051324-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051324-A01-1-2-1.jpg
Application image note: SPG21 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of SPG21 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPG21 polyclonal antibody (A01) now

Add to cart