Brand: | Abnova |
Reference: | H00051324-A01 |
Product name: | SPG21 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SPG21. |
Gene id: | 51324 |
Gene name: | SPG21 |
Gene alias: | ACP33|BM-019|GL010|MASPARDIN|MAST |
Gene description: | spastic paraplegia 21 (autosomal recessive, Mast syndrome) |
Genbank accession: | NM_016630 |
Immunogen: | SPG21 (NP_057714, 211 a.a. ~ 306 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE |
Protein accession: | NP_057714 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SPG21 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of SPG21 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |