Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TLR8 monoclonal antibody (M01), clone 4C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about TLR8 monoclonal antibody (M01), clone 4C6
| Brand: | Abnova |
| Reference: | H00051311-M01 |
| Product name: | TLR8 monoclonal antibody (M01), clone 4C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR8. |
| Clone: | 4C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51311 |
| Gene name: | TLR8 |
| Gene alias: | CD288|MGC119599|MGC119600 |
| Gene description: | toll-like receptor 8 |
| Genbank accession: | NM_138636 |
| Immunogen: | TLR8 (NP_619542, 723 a.a. ~ 825 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD |
| Protein accession: | NP_619542 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TLR8 monoclonal antibody (M01), clone 4C6 Western Blot analysis of TLR8 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Phagosomal signaling by Borrelia burgdorferi in human monocytes involves Toll-like receptor (TLR) 2 and TLR8 cooperativity and TLR8-mediated induction of IFN-{beta}.Cervantes JL, Dunham-Ems SM, La Vake CJ, Petzke MM, Sahay B, Sellati TJ, Radolf JD, Salazar JC. Proc Natl Acad Sci U S A. 2011 Mar 1;108(9):3683-8. Epub 2011 Feb 14. |