FKBP11 purified MaxPab mouse polyclonal antibody (B01P) View larger

FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051303-B01P
Product name: FKBP11 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FKBP11 protein.
Gene id: 51303
Gene name: FKBP11
Gene alias: FKBP19|MGC54182
Gene description: FK506 binding protein 11, 19 kDa
Genbank accession: NM_016594.1
Immunogen: FKBP11 (NP_057678.1, 1 a.a. ~ 201 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Protein accession: NP_057678.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051303-B01P-13-15-1.jpg
Application image note: Western Blot analysis of FKBP11 expression in transfected 293T cell line (H00051303-T01) by FKBP11 MaxPab polyclonal antibody.

Lane 1: FKBP11 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FKBP11 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart