No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051297-P01 |
Product name: | PLUNC (Human) Recombinant Protein (P01) |
Product description: | Human PLUNC full-length ORF ( AAH12549.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 51297 |
Gene name: | PLUNC |
Gene alias: | LPLUNC3|LUNX|NASG|SPLUNC1|SPURT|bA49G10.5 |
Gene description: | palate, lung and nasal epithelium associated |
Genbank accession: | BC012549 |
Immunogen sequence/protein sequence: | MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV |
Protein accession: | AAH12549.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification of Lipocalin and Apolipoprotein A1 as Biomarkers of Chronic Obstructive Pulmonary Disease.Nicholas BL, Skipp P, Barton S, Singh D, Bagmane D, Mould R, Angco G, Ward J, Guha-Niyogi B, Wilson S, Howarth P, Davies DE, Rennard S, O'Connor CD, Djukanovic R. Am J Respir Crit Care Med. 2010 Jan 28. [Epub ahead of print] |