Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLUNC monoclonal antibody (M05), clone 3C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLUNC monoclonal antibody (M05), clone 3C1
| Brand: | Abnova |
| Reference: | H00051297-M05 |
| Product name: | PLUNC monoclonal antibody (M05), clone 3C1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLUNC. |
| Clone: | 3C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51297 |
| Gene name: | PLUNC |
| Gene alias: | LPLUNC3|LUNX|NASG|SPLUNC1|SPURT|bA49G10.5 |
| Gene description: | palate, lung and nasal epithelium associated |
| Genbank accession: | BC012549 |
| Immunogen: | PLUNC (AAH12549.1, 1 a.a. ~ 256 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV |
| Protein accession: | AAH12549.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |