CD320 monoclonal antibody (M04), clone 4F2 View larger

CD320 monoclonal antibody (M04), clone 4F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD320 monoclonal antibody (M04), clone 4F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about CD320 monoclonal antibody (M04), clone 4F2

Brand: Abnova
Reference: H00051293-M04
Product name: CD320 monoclonal antibody (M04), clone 4F2
Product description: Mouse monoclonal antibody raised against a full-length recombinant CD320.
Clone: 4F2
Isotype: IgG2a Kappa
Gene id: 51293
Gene name: CD320
Gene alias: 8D6|8D6A
Gene description: CD320 molecule
Genbank accession: BC000668
Immunogen: CD320 (AAH00668, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Protein accession: AAH00668
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051293-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00051293-M04-1-27-1.jpg
Application image note: CD320 monoclonal antibody (M04), clone 4F2. Western Blot analysis of CD320 expression in Raw 264.7.
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD320 monoclonal antibody (M04), clone 4F2 now

Add to cart