Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GOLM1 monoclonal antibody (M06A), clone 5B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about GOLM1 monoclonal antibody (M06A), clone 5B10
| Brand: | Abnova |
| Reference: | H00051280-M06A |
| Product name: | GOLM1 monoclonal antibody (M06A), clone 5B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GOLM1. |
| Clone: | 5B10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51280 |
| Gene name: | GOLM1 |
| Gene alias: | C9orf155|FLJ22634|FLJ23608|GOLPH2|GP73|PSEC0257|bA379P1.3 |
| Gene description: | golgi membrane protein 1 |
| Genbank accession: | NM_016548 |
| Immunogen: | GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
| Protein accession: | NP_057632 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 monoclonal antibody (M06A), clone 5B10. Lane 1: GOLM1 transfected lysate(45.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |