TFDP3 monoclonal antibody (M02), clone 3F11 View larger

TFDP3 monoclonal antibody (M02), clone 3F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFDP3 monoclonal antibody (M02), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TFDP3 monoclonal antibody (M02), clone 3F11

Brand: Abnova
Reference: H00051270-M02
Product name: TFDP3 monoclonal antibody (M02), clone 3F11
Product description: Mouse monoclonal antibody raised against a partial recombinant TFDP3.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 51270
Gene name: TFDP3
Gene alias: CT30|E2F-like|HCA661|MGC161639
Gene description: transcription factor Dp family, member 3
Genbank accession: NM_016521
Immunogen: TFDP3 (NP_057605, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI
Protein accession: NP_057605
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051270-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00051270-M02-1-19-1.jpg
Application image note: TFDP3 monoclonal antibody (M02), clone 3F11 Western Blot analysis of TFDP3 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFDP3 monoclonal antibody (M02), clone 3F11 now

Add to cart