| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00051268-M10 |
| Product name: | PIPOX monoclonal antibody (M10), clone 3D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIPOX. |
| Clone: | 3D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51268 |
| Gene name: | PIPOX |
| Gene alias: | LPIPOX |
| Gene description: | pipecolic acid oxidase |
| Genbank accession: | BC027622.1 |
| Immunogen: | PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG |
| Protein accession: | AAH27622.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1. Lane 1: PIPOX transfected lysate(44.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The role of sarcosine metabolism in prostate cancer progression.Khan AP, Rajendiran TM, Ateeq B, Asangani IA, Athanikar JN, Yocum AK, Mehra R, Siddiqui J, Palapattu G, Wei JT, Michailidis G, Sreekumar A, Chinnaiyan AM Neoplasia. 2013 May;15(5):491-501. |