PIPOX purified MaxPab rabbit polyclonal antibody (D01P) View larger

PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00051268-D01P
Product name: PIPOX purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PIPOX protein.
Gene id: 51268
Gene name: PIPOX
Gene alias: LPIPOX
Gene description: pipecolic acid oxidase
Genbank accession: NM_016518
Immunogen: PIPOX (NP_057602.2, 1 a.a. ~ 390 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL
Protein accession: NP_057602.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051268-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PIPOX expression in transfected 293T cell line (H00051268-T01) by PIPOX MaxPab polyclonal antibody.

Lane 1: PIPOX transfected lysate(44.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PIPOX purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart