| Brand: | Abnova |
| Reference: | H00051267-M01 |
| Product name: | CLEC1A monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CLEC1A. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51267 |
| Gene name: | CLEC1A |
| Gene alias: | CLEC1|MGC34328 |
| Gene description: | C-type lectin domain family 1, member A |
| Genbank accession: | BC039072 |
| Immunogen: | CLEC1A (AAH39072, 1 a.a. ~ 280 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPRTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD |
| Protein accession: | AAH39072 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CLEC1A is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |