No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00051258-M09 |
| Product name: | MRPL51 monoclonal antibody (M09), clone 1H5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MRPL51. |
| Clone: | 1H5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51258 |
| Gene name: | MRPL51 |
| Gene alias: | CDA09|HSPC241|MRP64|bMRP64 |
| Gene description: | mitochondrial ribosomal protein L51 |
| Genbank accession: | BC000191 |
| Immunogen: | MRPL51 (AAH00191, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR |
| Protein accession: | AAH00191 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |