Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of MARCH2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MARCH2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00051257-B01P |
| Product name: | MARCH2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MARCH2 protein. |
| Gene id: | 51257 |
| Gene name: | MARCH2 |
| Gene alias: | HSPC240|MARCH-II|RNF172 |
| Gene description: | membrane-associated ring finger (C3HC4) 2 |
| Genbank accession: | NM_001005416.1 |
| Immunogen: | MARCH2 (NP_001005416.1, 1 a.a. ~ 176 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV |
| Protein accession: | NP_001005416.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MARCH2 expression in transfected 293T cell line (H00051257-T01) by MARCH2 MaxPab polyclonal antibody. Lane 1: MARCH2 transfected lysate(19.36 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound β(2)-adrenergic receptors.Han SO, Xiao K, Kim J, Wu JH, Wisler JW, Nakamura N, Freedman NJ, Shenoy SK. J Cell Biol. 2012 Nov 26;199(5):817-30. doi: 10.1083/jcb.201208192. Epub 2012 Nov 19. |