Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MARCH2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MARCH2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051257-A01 |
| Product name: | MARCH2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MARCH2. |
| Gene id: | 51257 |
| Gene name: | MARCH2 |
| Gene alias: | HSPC240|MARCH-II|RNF172 |
| Gene description: | membrane-associated ring finger (C3HC4) 2 |
| Genbank accession: | NM_016496 |
| Immunogen: | 40970 (NP_057580, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS |
| Protein accession: | NP_057580 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound β(2)-adrenergic receptors.Han SO, Xiao K, Kim J, Wu JH, Wisler JW, Nakamura N, Freedman NJ, Shenoy SK. J Cell Biol. 2012 Nov 26;199(5):817-30. doi: 10.1083/jcb.201208192. Epub 2012 Nov 19. |