Brand: | Abnova |
Reference: | H00051257-A01 |
Product name: | MARCH2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MARCH2. |
Gene id: | 51257 |
Gene name: | MARCH2 |
Gene alias: | HSPC240|MARCH-II|RNF172 |
Gene description: | membrane-associated ring finger (C3HC4) 2 |
Genbank accession: | NM_016496 |
Immunogen: | 40970 (NP_057580, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS |
Protein accession: | NP_057580 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound β(2)-adrenergic receptors.Han SO, Xiao K, Kim J, Wu JH, Wisler JW, Nakamura N, Freedman NJ, Shenoy SK. J Cell Biol. 2012 Nov 26;199(5):817-30. doi: 10.1083/jcb.201208192. Epub 2012 Nov 19. |