View larger

NT5C3 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of NT5C3 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00051251-B01P
Product name:	NT5C3 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human NT5C3 protein.
Gene id:	51251
Gene name:	NT5C3
Gene alias:	MGC27337\|MGC87109\|MGC87828\|P5'N-1\|PN-I\|PSN1\|UMPH\|UMPH1\|cN-III
Gene description:	5'-nucleotidase, cytosolic III
Genbank accession:	BC015856
Immunogen:	NT5C3 (AAH15856, 1 a.a. ~ 286 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Protein accession:	AAH15856
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of NT5C3 expression in transfected 293T cell line (H00051251-T01) by NT5C3 MaxPab polyclonal antibody. Lane 1: NT5C3 transfected lysate(31.57 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice