Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051251-B01P |
Product name: | NT5C3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NT5C3 protein. |
Gene id: | 51251 |
Gene name: | NT5C3 |
Gene alias: | MGC27337|MGC87109|MGC87828|P5'N-1|PN-I|PSN1|UMPH|UMPH1|cN-III |
Gene description: | 5'-nucleotidase, cytosolic III |
Genbank accession: | BC015856 |
Immunogen: | NT5C3 (AAH15856, 1 a.a. ~ 286 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL |
Protein accession: | AAH15856 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NT5C3 expression in transfected 293T cell line (H00051251-T01) by NT5C3 MaxPab polyclonal antibody. Lane 1: NT5C3 transfected lysate(31.57 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |