No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00051246-M03 |
| Product name: | SHISA5 monoclonal antibody (M03), clone 3G5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SHISA5. |
| Clone: | 3G5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51246 |
| Gene name: | SHISA5 |
| Gene alias: | SCOTIN|hShisa5 |
| Gene description: | shisa homolog 5 (Xenopus laevis) |
| Genbank accession: | BC001463 |
| Immunogen: | SHISA5 (AAH01463, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL |
| Protein accession: | AAH01463 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |