View larger

MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00051237-B02P
Product name:	MGC29506 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human MGC29506 protein.
Gene id:	51237
Gene name:	MGC29506
Gene alias:	FLJ32987\|PACAP
Gene description:	hypothetical protein MGC29506
Genbank accession:	BC021275.2
Immunogen:	MGC29506 (NP_057543.2, 1 a.a. ~ 189 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Protein accession:	NP_057543.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MGC29506 expression in transfected 293T cell line (H00051237-T02) by MGC29506 MaxPab polyclonal antibody. Lane 1: PACAP transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice