NUSAP1 purified MaxPab mouse polyclonal antibody (B01P) View larger

NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051203-B01P
Product name: NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NUSAP1 protein.
Gene id: 51203
Gene name: NUSAP1
Gene alias: ANKT|BM037|FLJ13421|LNP|PRO0310p1|Q0310|SAPL
Gene description: nucleolar and spindle associated protein 1
Genbank accession: NM_016359
Immunogen: NUSAP1 (NP_057443.1, 1 a.a. ~ 226 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED
Protein accession: NP_057443.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051203-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NUSAP1 expression in transfected 293T cell line (H00051203-T02) by NUSAP1 MaxPab polyclonal antibody.

Lane 1: NUSAP1 transfected lysate(24.86 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUSAP1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart