SS18L2 MaxPab mouse polyclonal antibody (B03) View larger

SS18L2 MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SS18L2 MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SS18L2 MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00051188-B03
Product name: SS18L2 MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human SS18L2 protein.
Gene id: 51188
Gene name: SS18L2
Gene alias: KIAA-iso
Gene description: synovial sarcoma translocation gene on chromosome 18-like 2
Genbank accession: BC017804.1
Immunogen: SS18L2 (AAH17804.1, 1 a.a. ~ 77 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYLNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME
Protein accession: AAH17804.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051188-B03-13-15-1.jpg
Application image note: Western Blot analysis of SS18L2 expression in transfected 293T cell line (H00051188-T03) by SS18L2 MaxPab polyclonal antibody.

Lane 1: SS18L2 transfected lysate(8.58 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SS18L2 MaxPab mouse polyclonal antibody (B03) now

Add to cart