| Brand: | Abnova |
| Reference: | H00051181-M03 |
| Product name: | DCXR monoclonal antibody (M03), clone 6A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCXR. |
| Clone: | 6A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51181 |
| Gene name: | DCXR |
| Gene alias: | DCR|HCR2|HCRII|KIDCR|P34H|SDR20C1 |
| Gene description: | dicarbonyl/L-xylulose reductase |
| Genbank accession: | NM_016286 |
| Immunogen: | DCXR (NP_057370, 145 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC |
| Protein accession: | NP_057370 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DCXR monoclonal antibody (M03), clone 6A6 Western Blot analysis of DCXR expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |