| Brand: | Abnova |
| Reference: | H00051176-M01 |
| Product name: | LEF1 monoclonal antibody (M01), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LEF1. |
| Clone: | 3H5 |
| Isotype: | IgG1 kappa |
| Gene id: | 51176 |
| Gene name: | LEF1 |
| Gene alias: | DKFZp586H0919|TCF1ALPHA |
| Gene description: | lymphoid enhancer-binding factor 1 |
| Genbank accession: | BC050632 |
| Immunogen: | LEF1 (AAH50632, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI |
| Protein accession: | AAH50632 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (69.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LEF1 monoclonal antibody (M01), clone 3H5 Western Blot analysis of LEF1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Rac1 augments Wnt signaling by stimulating β-catenin-LEF-1 complex assembly independent of β-catenin nuclear import.Jamieson C, Lui C, Brocardo MG, Martino-Echarri E, Henderson BR. J Cell Sci. 2015 Nov 1;128(21):3933-46. |