DHRS10 MaxPab mouse polyclonal antibody (B01) View larger

DHRS10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHRS10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DHRS10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00051171-B01
Product name: DHRS10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DHRS10 protein.
Gene id: 51171
Gene name: HSD17B14
Gene alias: DHRS10|SDR47C1|retSDR3
Gene description: hydroxysteroid (17-beta) dehydrogenase 14
Genbank accession: NM_016246.2
Immunogen: DHRS10 (NP_057330.2, 1 a.a. ~ 270 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Protein accession: NP_057330.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051171-B01-13-15-1.jpg
Application image note: Western Blot analysis of HSD17B14 expression in transfected 293T cell line (H00051171-T01) by HSD17B14 MaxPab polyclonal antibody.

Lane 1: DHRS10 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DHRS10 MaxPab mouse polyclonal antibody (B01) now

Add to cart