Brand: | Abnova |
Reference: | H00051166-A01 |
Product name: | AADAT polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant AADAT. |
Gene id: | 51166 |
Gene name: | AADAT |
Gene alias: | KAT2|KATII |
Gene description: | aminoadipate aminotransferase |
Genbank accession: | NM_016228 |
Immunogen: | AADAT (NP_057312, 326 a.a. ~ 425 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL |
Protein accession: | NP_057312 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Characterization of the Kynurenine Pathway in Human Neurons.Guillemin GJ, Cullen KM, Lim CK, Smythe GA, Garner B, Kapoor V, Takikawa O, Brew BJ. J Neurosci. 2007 Nov 21;27(47):12884-92. |