| Brand: | Abnova |
| Reference: | H00051151-D01P |
| Product name: | SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SLC45A2 protein. |
| Gene id: | 51151 |
| Gene name: | SLC45A2 |
| Gene alias: | 1A1|AIM1|MATP|SHEP5 |
| Gene description: | solute carrier family 45, member 2 |
| Genbank accession: | NM_001012509.1 |
| Immunogen: | SLC45A2 (NP_001012527.1, 1 a.a. ~ 460 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQDPPLSSDGMYEYGSIEKVKNGYVNPELAMQGAKNKNHAEQTRRAMTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPNVYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKEVCCH |
| Protein accession: | NP_001012527.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLC45A2 MaxPab rabbit polyclonal antibody. Western Blot analysis of SLC45A2 expression in HeLa. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |