Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HSD17B12 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about HSD17B12 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051144-A01 |
| Product name: | HSD17B12 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HSD17B12. |
| Gene id: | 51144 |
| Gene name: | HSD17B12 |
| Gene alias: | KAR|SDR12C1 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 12 |
| Genbank accession: | NM_016142 |
| Immunogen: | HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG |
| Protein accession: | NP_057226 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HSD17B12 polyclonal antibody (A01), Lot # 051122JCO1 Western Blot analysis of HSD17B12 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Overexpression of 17β-Hydroxysteroid Dehydrogenase Type 1 Increases the Exposure of Endometrial Cancer to 17β-Estradiol.Cornel KM, Kruitwagen RF, Delvoux B, Visconti L, Van de Vijver KK, Day JM, Van Gorp T, Hermans RJ, Dunselman GA, Romano A. J Clin Endocrinol Metab. 2012 Feb 22. [Epub ahead of print] |