No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051136-M01 |
Product name: | LOC51136 monoclonal antibody (M01), clone 4H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LOC51136. |
Clone: | 4H7 |
Isotype: | IgG2a Kappa |
Gene id: | 51136 |
Gene name: | RNFT1 |
Gene alias: | MGC111090|PTD016 |
Gene description: | ring finger protein, transmembrane 1 |
Genbank accession: | NM_016125 |
Immunogen: | LOC51136 (NP_057209, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG |
Protein accession: | NP_057209 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody (M01), clone 4H7. Lane 1: LOC51136 transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |