| Brand: | Abnova |
| Reference: | H00051135-M07 |
| Product name: | IRAK4 monoclonal antibody (M07), clone 3C5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IRAK4. |
| Clone: | 3C5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51135 |
| Gene name: | IRAK4 |
| Gene alias: | IPD1|NY-REN-64|REN64 |
| Gene description: | interleukin-1 receptor-associated kinase 4 |
| Genbank accession: | NM_016123 |
| Immunogen: | IRAK4 (NP_057207, 255 a.a. ~ 351 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT |
| Protein accession: | NP_057207 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |