No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00051135-M04 |
| Product name: | IRAK4 monoclonal antibody (M04), clone 2D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IRAK4. |
| Clone: | 2D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51135 |
| Gene name: | IRAK4 |
| Gene alias: | IPD1|NY-REN-64|REN64 |
| Gene description: | interleukin-1 receptor-associated kinase 4 |
| Genbank accession: | BC013316 |
| Immunogen: | IRAK4 (AAH13316, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDK |
| Protein accession: | AAH13316 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | IRAK4 monoclonal antibody (M04), clone 2D3 Western Blot analysis of IRAK4 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |