Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF12 monoclonal antibody (M01), clone 1G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about RNF12 monoclonal antibody (M01), clone 1G10
| Brand: | Abnova |
| Reference: | H00051132-M01 |
| Product name: | RNF12 monoclonal antibody (M01), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF12. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51132 |
| Gene name: | RNF12 |
| Gene alias: | MGC15161|NY-REN-43|RLIM |
| Gene description: | ring finger protein 12 |
| Genbank accession: | NM_016120 |
| Immunogen: | RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN |
| Protein accession: | NP_057204 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse.Federici F, Magaraki A, Wassenaar E, van Veen-Buurman CJ, van de Werken C, Baart EB, Laven JS, Grootegoed JA, Gribnau J, Baarends WM. PLoS Genet. 2016 Oct 7;12(10):e1006358. |