Cart 43 Product Products 16 767,00 € (empty)
No products
To be determined Shipping
16 767,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 43 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 767,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 767,00 €
Data sheet of PHF11 monoclonal antibody (M01), clone 3B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PHF11 monoclonal antibody (M01), clone 3B8
| Brand: | Abnova |
| Reference: | H00051131-M01 |
| Product name: | PHF11 monoclonal antibody (M01), clone 3B8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PHF11. |
| Clone: | 3B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51131 |
| Gene name: | PHF11 |
| Gene alias: | APY|BCAP|IGEL|IGER|IGHER|NY-REN-34|NYREN34 |
| Gene description: | PHD finger protein 11 |
| Genbank accession: | BC017212 |
| Immunogen: | PHF11 (AAH17212, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY |
| Protein accession: | AAH17212 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PHF11 expression in transfected 293T cell line by PHF11 monoclonal antibody (M01), clone 3B8. Lane 1: PHF11 transfected lysate(33.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |