Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ANGPTL4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ANGPTL4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051129-A01 |
| Product name: | ANGPTL4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant ANGPTL4. |
| Gene id: | 51129 |
| Gene name: | ANGPTL4 |
| Gene alias: | ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158 |
| Gene description: | angiopoietin-like 4 |
| Genbank accession: | BC023647 |
| Immunogen: | ANGPTL4 (AAH23647.1, 26 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS |
| Protein accession: | AAH23647.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (68.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Angiopoietin-like protein 4 (ANGPTL4) is induced by high glucose in retinal pigment epithelial cells and exhibits potent angiogenic activity on retinal endothelial cells.Yokouchi H, Eto K, Nishimura W, Takeda N, Kaburagi Y, Yamamoto S, Yasuda K Acta Ophthalmol. 2013 Feb 7. doi: 10.1111/aos.12097. |