No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
Brand: | Abnova |
Reference: | H00051125-M01 |
Product name: | GOLGA7 monoclonal antibody (M01), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GOLGA7. |
Clone: | 2H8 |
Isotype: | IgG2a Kappa |
Gene id: | 51125 |
Gene name: | GOLGA7 |
Gene alias: | GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876 |
Gene description: | golgi autoantigen, golgin subfamily a, 7 |
Genbank accession: | BC012032 |
Immunogen: | GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR |
Protein accession: | AAH12032 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (40.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GOLGA7 monoclonal antibody (M01), clone 2H8 Western Blot analysis of GOLGA7 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |
Publications: | Palmitoylation of oncogenic NRAS is essential for leukemogenesis.Cuiffo B, Ren R. Blood. 2010 Apr 29;115(17):3598-605. Epub 2010 Mar 3. |