Cart 41 Product Products 13 366,07 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
13 366,07 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 41 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 13 366,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 13 366,07 €
Data sheet of GOLGA7 monoclonal antibody (M01), clone 2H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
More info about GOLGA7 monoclonal antibody (M01), clone 2H8
| Brand: | Abnova |
| Reference: | H00051125-M01 |
| Product name: | GOLGA7 monoclonal antibody (M01), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GOLGA7. |
| Clone: | 2H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51125 |
| Gene name: | GOLGA7 |
| Gene alias: | GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876 |
| Gene description: | golgi autoantigen, golgin subfamily a, 7 |
| Genbank accession: | BC012032 |
| Immunogen: | GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR |
| Protein accession: | AAH12032 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GOLGA7 monoclonal antibody (M01), clone 2H8 Western Blot analysis of GOLGA7 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Palmitoylation of oncogenic NRAS is essential for leukemogenesis.Cuiffo B, Ren R. Blood. 2010 Apr 29;115(17):3598-605. Epub 2010 Mar 3. |