| Brand: | Abnova |
| Reference: | H00051099-M02 |
| Product name: | ABHD5 monoclonal antibody (M02), clone 4B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABHD5. |
| Clone: | 4B12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51099 |
| Gene name: | ABHD5 |
| Gene alias: | CDS|CGI58|IECN2|MGC8731|NCIE2 |
| Gene description: | abhydrolase domain containing 5 |
| Genbank accession: | NM_016006 |
| Immunogen: | ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK |
| Protein accession: | NP_057090 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ABHD5 monoclonal antibody (M02), clone 4B12 Western Blot analysis of ABHD5 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Adipose Triglyceride Lipase Regulation of Skeletal Muscle Lipid Metabolism and Insulin Responsiveness.Watt MJ, van Denderen BJ, Castelli LA, Bruce CR, Hoy AJ, Kraegen EW, Macaulay L, Kemp BE. Mol Endocrinol. 2008 May;22(5):1200-12. Epub 2008 Jan 17. |