No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051099-A02 |
Product name: | ABHD5 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ABHD5. |
Gene id: | 51099 |
Gene name: | ABHD5 |
Gene alias: | CDS|CGI58|IECN2|MGC8731|NCIE2 |
Gene description: | abhydrolase domain containing 5 |
Genbank accession: | NM_016006 |
Immunogen: | ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK |
Protein accession: | NP_057090 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | ABHD5 polyclonal antibody (A02), Lot # 060103JC01 Western Blot analysis of ABHD5 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |