Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GAL monoclonal antibody (M01A), clone 3C1-G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about GAL monoclonal antibody (M01A), clone 3C1-G5
| Brand: | Abnova |
| Reference: | H00051083-M01A |
| Product name: | GAL monoclonal antibody (M01A), clone 3C1-G5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant GAL. |
| Clone: | 3C1-G5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51083 |
| Gene name: | GAL |
| Gene alias: | GALN|GLNN|GMAP|MGC40167 |
| Gene description: | galanin prepropeptide |
| Genbank accession: | BC030241 |
| Immunogen: | GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Protein accession: | AAH30241 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.27 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GAL expression in transfected 293T cell line by GAL monoclonal antibody (M01A), clone 3C1-G5. Lane 1: GAL transfected lysate (Predicted MW: 13.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |