| Brand: | Abnova |
| Reference: | H00051079-B02P |
| Product name: | NDUFA13 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NDUFA13 protein. |
| Gene id: | 51079 |
| Gene name: | NDUFA13 |
| Gene alias: | B16.6|CDA016|CGI-39|GRIM-19|GRIM19 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 |
| Genbank accession: | BC009189 |
| Immunogen: | NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT |
| Protein accession: | AAH09189.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NDUFA13 MaxPab polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver. |
| Applications: | WB-Ti,IHC-P,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differentially expressed proteins in malignant and benign adrenocortical tumors.Kjellin H, Johansson H, Hoog A, Lehtio J, Jakobsson PJ, Kjellman M PLoS One. 2014 Feb 3;9(2):e87951. doi: 10.1371/journal.pone.0087951. eCollection 2014. |